PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g074500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 305aa    MW: 34062.8 Da    PI: 4.5799
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g074500.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-1972125356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe ++++  e++ +LA++lgL+ rqV +WFqNrRa++k
  Csa02g074500.1  72 KKRRLSVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWK 125
                     56689************************************************9 PP

2HD-ZIP_I/II130.28.2e-4271163193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrls eqvk+LE++Fe ++kLeperKv+la+eLglqprqva+WFqnrRAR+ktkqlE+dy +Lk+++dalk+++++L++++++L  ++ke
  Csa02g074500.1  71 EKKRRLSVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALKRSRDSLQRDNDSLLGQIKE 163
                     69*************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-2058129IPR009057Homeodomain-like
PROSITE profilePS5007117.83167127IPR001356Homeobox domain
SMARTSM003891.3E-1870131IPR001356Homeobox domain
PfamPF000462.3E-1672125IPR001356Homeobox domain
CDDcd000861.73E-1872128No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2074134IPR009057Homeodomain-like
PRINTSPR000317.4E-698107IPR000047Helix-turn-helix motif
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PRINTSPR000317.4E-6107123IPR000047Helix-turn-helix motif
PfamPF021836.6E-17127168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MKRSRGSSDS LVGFLPIRNS TTDKQISPRP TNTGFLYSGA GDYSQMFDAL DDDGSLDDMG  60
GVGHASSTAA EKKRRLSVEQ VKALEKNFEI DNKLEPERKV KLAQELGLQP RQVAIWFQNR  120
RARWKTKQLE RDYGVLKSNF DALKRSRDSL QRDNDSLLGQ IKELRAKLNV DGEENGVIKA  180
TEANQTVMMA NNEVLELNHR PPSPPIPTEA PAPTSELAYE MFSIFPRTES FREDPADSSD  240
SSAVLNEEYS PTTVEAAGAV AATTMDCFSQ FVKMEEHEDL FSGEEACKLF ADNEQWYCSD  300
QWNS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119127RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00587DAPTransfer from AT5G65310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3250540.0AF325054.2 Arabidopsis thaliana AT5g65310 (AT5g65310/MNA5_4) mRNA, complete cds.
GenBankAY0742930.0AY074293.1 Arabidopsis thaliana putative homeobox-leucine zipper protein ATHB-5 (At5g65310) mRNA, complete cds.
GenBankAY0913400.0AY091340.1 Arabidopsis thaliana putative homeobox-leucine zipper protein ATHB-5 (HD-zip protein ATHB-5) (At5g65310) mRNA, complete cds.
GenBankX670330.0X67033.1 A.thaliana mRNA Athb-5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010463203.10.0PREDICTED: homeobox-leucine zipper protein ATHB-5
SwissprotP466670.0ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5
TrEMBLR0GN080.0R0GN08_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.666__2__AT5G65310.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM129861526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.11e-162homeobox protein 5